Cat: PA2000-2731

Recombinant Human PPIA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PPIA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PPIA;CYPA;Peptidyl-prolyl cis-trans isomerase A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0AFL5

  • Expression Region

    25-190aa

  • AA Sequence

    AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVI PGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSAT SQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQ NVPSKPVVILSAKVLP

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of PPIA (Peptidyl-Prolyl Isomerase A), also known as cyclophilin A, has gained significant attention in the field of molecular biology due to its crucial role in protein folding and cellular regulation. PPIA is a member of the peptidyl-prolyl isomerase family, which facilitates the cis-trans isomerization of proline residues in polypeptides, thereby influencing protein conformation and activity. Beyond its fundamental biochemical actions, PPIA has been implicated in various physiological and pathological processes, including immune response, inflammation, and viral replication, particularly in relation to HIV-1, where it acts as a cofactor for the virus's life cycle. Additionally, PPIA has been linked to several disease states, including cancer, where its overexpression is associated with increased tumor growth and poor prognosis. Given its diverse biological functions and relevance to human health, researchers are focused on exploring the potential of PPIA as a therapeutic target. Recent advances in recombinant protein technology have enabled the production of PPIA in various expression systems, allowing for in-depth structural and functional studies. This research not only enhances our understanding of PPIA's multifaceted roles but also paves the way for the development of novel pharmacological interventions aimed at modulating its activity in disease settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US