Analytical Data
-
Gene name
ART4
- Application
-
Alternative Names
ART4；ART4；NOB1P；PSMD8BP1；RNA-binding Protein NOB1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q93070
-
Expression Region
47-285aa
-
AA Sequence
ADPSEVAIKIDFDFAPGSFDDQYQGCSKQVMEKLTQGDYFTKDIEAQKNY FRMWQKAHLAWLNQGKVLPQNMTTTHAVAILFYTLNSNVHSDFTRAMASV ARTPQQYERSFHFKYLHYYLTSAIQLLRKDSIMENGTLCYEVHYRTKDVH FNAYTGATIRFGQFLSTSLLKEEAQEFGNQTLFTIFTCLGAPVQYFSLKK EVLIPPYELFKVINMSYHPRGDWLQLRSTGNLSTYNCQLLKAHHHHHH
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ART4, a member of the ART (ADP-ribosyltransferase) family, has garnered attention in recent years due to its unique enzymatic properties and potential implications in cell signaling, immune response, and disease processes. This protein is known to catalyze the transfer of ADP-ribose from NAD+ to target proteins, a post-translational modification that can significantly alter protein function and regulate various cellular pathways. Research indicates that ART4 plays a pivotal role in modulating immune cell activation, particularly in the context of T lymphocytes, by influencing their proliferation and differentiation. Additionally, aberrant expression or activity of ART4 has been linked to various pathological conditions, including autoimmune diseases and cancers, leading to an increasing interest in its role as a therapeutic target. Understanding the molecular mechanisms underlying ART4’s function could provide valuable insights into potential interventions for these diseases. Recent studies utilizing advanced protein engineering and structural biology techniques have begun to unravel the intricacies of ART4's active site and how it interacts with substrates, which could pave the way for the development of specific inhibitors or modulators. Overall, the exploration of ART4 and its biochemical pathways not only broadens our understanding of protein modifications in cellular biology but also holds promise for new therapeutic strategies in the treatment of diseases associated with dysregulated ADP-ribosylation.
