Analytical Data
-
Gene name
XRP2
- Application
-
Alternative Names
XRP2；Protein XRP2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75695
-
Expression Region
1-350aa
-
AA Sequence
GCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
-
Molecular Weight
66.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
XRP2, a recombinant protein derived from the X protein of the Epstein-Barr virus (EBV), has garnered significant attention in the field of virology and immunology due to its potential role in viral pathogenesis and host immune responses. EBV is known for its association with various lymphoproliferative disorders and has a complex interaction with the immune system, making it a critical subject of study. The XRP2 protein specifically is implicated in the modulation of immune responses, potentially influencing the development of EBV-related diseases. Researchers are particularly interested in how XRP2 can alter the host's adaptive immune mechanisms, including its impact on T cell activation and cytokine production. Understanding the functional dynamics of XRP2 not only provides insights into the viral life cycle but also has broader implications for vaccine development and therapeutic interventions against EBV-associated malignancies. In recent studies, recombinant XRP2 has been produced and characterized, paving the way for exploring its immunogenic properties and interactions with host cells. This research is crucial for developing strategies to enhance immune responses against EBV and for creating effective treatments for EBV-related diseases, thereby addressing a significant public health challenge.
