Cat: PA2000-2719

Recombinant Human MAP3K7CL Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MAP3K7CL

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MAP3K7CL;C21orf7;TAK1L;MAP3K7 C-terminal-like Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P57077

  • Expression Region

    1-142aa

  • AA Sequence

    MISTARVPADKPVRIAFSLNDASDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS

  • Molecular Weight

    32.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MAP3K7CL, also known as MAP kinase activator 1, is a member of the mitogen-activated protein kinase (MAPK) signaling pathway, which plays a crucial role in various cellular processes, including proliferation, differentiation, and apoptosis. The significance of MAP3K7CL in cancer biology and other diseases has garnered attention due to its involvement in transducing signals from extracellular stimuli to intracellular responses. This protein functions as a kinase that activates downstream MAPK cascades, influencing cell fate decisions. Recent studies have suggested that dysregulation of MAP3K7CL may contribute to tumorigenesis and resistance to therapies, highlighting the necessity of understanding its molecular mechanisms. Additionally, research has pointed towards MAP3K7CL's potential as a therapeutic target, with recombinant protein studies paving the way for the development of new treatment strategies. By generating and investigating MAP3K7CL recombinant proteins, researchers aim to elucidate its interaction with other signaling molecules and pathways, enhance our understanding of its role in health and disease, and ultimately contribute to the discovery of novel interventions for related pathologies. This area of research continues to evolve, with ongoing studies focusing on the structural and functional characterization of MAP3K7CL, thus opening up new avenues for pharmacological exploitation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US