Analytical Data
-
Gene name
CALML6
- Application
-
Alternative Names
CALML6; CAGLP; CALGP; Calmodulin-like Protein 6; Calglandulin-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TD86
-
Expression Region
1-181aa
-
AA Sequence
MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLIQ
-
Molecular Weight
46.31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CALML6 (calmodulin-like protein 6) is a member of the calmodulin superfamily, which plays a pivotal role in calcium signaling and myriad cellular processes. The research into CALML6 is driven by its involvement in regulating calcium-dependent signaling pathways, which are essential for various physiological functions, including muscle contraction, neurotransmitter release, and gene expression. Recent studies have highlighted the potential link between CALML6 and various diseases, including cardiovascular disorders and neurodegenerative conditions. This has intensified interest in understanding its structure and function at the molecular level through recombinant protein technology. By producing CALML6 as a recombinant protein, researchers aim to investigate its biochemical properties, interaction with calcium ions, and binding partners. This research not only provides insights into its physiological roles but also paves the way for potential therapeutic applications, as targeting CALML6 could lead to innovative strategies for modulating calcium signaling in disease contexts. Elucidating the exact mechanisms by which CALML6 exerts its effects within cells will enhance our understanding of cellular calcium dynamics and facilitate the development of new treatments for disorders linked to calcium dysregulation. Thus, studies centered on the recombinant expression and functional analysis of CALML6 are crucial for advancing both fundamental biological knowledge and clinical applications.
