Analytical Data
-
Gene name
ompK
- Application
-
Alternative Names
ompK;Outer membrane Protein OmpK
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P59570
-
Expression Region
21-266aa
-
AA Sequence
ADYSDGDIHKNDYKWMQFNLMGAFDELPGESSHDYLEMEFGGRSGIFDLYGYVDVFNLASDKGSDKVGDPKIFMKFAPRMSIDGLTGKDLSFGPVQELYVATLFEWDGTDYKTNPFSVNNQKVGIGSDVMVPWFGKVGVNLYGTYQGNQKDWNGFQISTNWFKPFYFFENGSFISYQGYIDYQFGMKEKYSSASNGGAMFNGIYWHSDRFAVGYGLKGYKDVYGIKDSDALKSTGFGHYVAVTYKF
-
Molecular Weight
43.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The ompK gene, encoding a outer membrane porin protein in bacteria, has garnered significant attention in recent years due to its role in antibiotic resistance and bacterial pathogenesis. These porins facilitate the diffusion of small molecules, including nutrients and antibiotics, across the bacterial outer membrane, thus influencing the susceptibility of bacteria to various antimicrobial agents. Researchers have increasingly focused on the ompK gene, especially in clinically relevant pathogens such as Klebsiella pneumoniae, where mutations and variations in ompK expression can lead to multi-drug resistance. Understanding the structure and function of OmpK proteins is crucial for developing novel therapeutic strategies, as they often serve as gateways that can either mitigate or exacerbate the effectiveness of treatments. Additionally, the study of ompK recombinants has implications for vaccine development and the design of alternative treatment options, given their potential to elicit immune responses. Overall, the exploration of ompK recombinant proteins not only provides insights into bacterial survival mechanisms but also holds promise for addressing the growing challenge of antibiotic resistance in healthcare settings worldwide.











