Analytical Data
-
Gene name
VP3
- Application
-
Alternative Names
VP3；Vacuolar Protein sorting-associated Protein 33A
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54095
-
Expression Region
1-120aa
-
AA Sequence
MNALQEDTPPGPSTVFRPPTSSRPLETPHCEIRIGIAGITITLSLCGCAN ARAPTLRSATADSSESTGFKNAPDLRTDQPKPPSKKRSCDPSEYRVSELK ENLITTTPSRPRTARRCIRL
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VP3 recombinant protein has garnered significant attention in the field of virology and immunology due to its role as an important structural protein found in various viruses, particularly in picornaviruses. This protein is crucial for viral assembly and has been identified as a key target for vaccine development, as it plays a vital role in evoking an immune response. Research into VP3 focuses on understanding its function in viral pathogenesis, host interactions, and immune evasion mechanisms. By utilizing recombinant DNA technology to produce VP3 proteins, scientists can study their properties and interactions in detail. Such studies can lead to the development of novel therapeutics and vaccines, providing critical insights into viral diseases and their prevention. Moreover, VP3's potential as a biomarker for viral infection enhances its relevance in diagnostic research. Overall, the investigation of VP3 recombinant protein is essential for advancing our knowledge of viral biology and for the innovation of effective strategies against viral infections.
