Analytical Data
-
Gene name
ponA
- Application
-
Alternative Names
ponA;Garlh4;Kiaa4027;Lh4;LHFPL tetraspan subfamily member 4 Protein
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P39793
-
Expression Region
774-914aa
-
AA Sequence
AVSDDGKSTASTSYEVPKAEDDEDKKDQQQTDDEKQDDEKTQDDTQTDDSQKDDGQTDQDQTDDSTNDQDKKQDNTNTNPSDNNNQDQSNDNDNDNSNNQDTSDGDSNSGKNDSTGSDTNKNKTDTSNKTQTNSSSIEKTN
-
Molecular Weight
28.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PonA (Penicillin-binding protein A) is a crucial bacterial protein involved in the maintenance of cell wall integrity and the synthesis of peptidoglycan. Its significance lies in its role as a transpeptidase, facilitating the cross-linking of peptide chains in the bacterial cell wall, which is vital for bacterial growth and stability. The study of PonA has gained considerable attention in recent years, particularly due to its implications in antibiotic resistance. Penicillin and other beta-lactam antibiotics target penicillin-binding proteins to disrupt cell wall synthesis, rendering bacteria vulnerable to lysis. However, the emergence of PonA variants with altered binding affinities contributes to resistance against these antibiotics, posing a significant challenge in treating bacterial infections. Furthermore, understanding the structure-function relationship of PonA can provide insights into its enzymatic mechanisms and help identify potential therapeutic targets. Researchers are increasingly interested in the recombinant expression of PonA to investigate its functional properties and interactions with antibiotics. This recombinant protein can be used in high-throughput screening assays to discover new inhibitors or adjuvants that may restore the efficacy of existing antibiotics. Additionally, PonA's role in bacterial physiology makes it a promising candidate for the development of novel antimicrobial strategies. Thus, ongoing studies on PonA recombination and its enzymatic functions are critical in addressing the growing concern of antibiotic resistance and advancing our understanding of bacterial cell wall biology.











