Cat: PA2000-2696

Recombinant E.coli ponA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ponA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ponA;Garlh4;Kiaa4027;Lh4;LHFPL tetraspan subfamily member 4 Protein

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P39793

  • Expression Region

    774-914aa

  • AA Sequence

    AVSDDGKSTASTSYEVPKAEDDEDKKDQQQTDDEKQDDEKTQDDTQTDDSQKDDGQTDQDQTDDSTNDQDKKQDNTNTNPSDNNNQDQSNDNDNDNSNNQDTSDGDSNSGKNDSTGSDTNKNKTDTSNKTQTNSSSIEKTN

  • Molecular Weight

    28.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PonA (Penicillin-binding protein A) is a crucial bacterial protein involved in the maintenance of cell wall integrity and the synthesis of peptidoglycan. Its significance lies in its role as a transpeptidase, facilitating the cross-linking of peptide chains in the bacterial cell wall, which is vital for bacterial growth and stability. The study of PonA has gained considerable attention in recent years, particularly due to its implications in antibiotic resistance. Penicillin and other beta-lactam antibiotics target penicillin-binding proteins to disrupt cell wall synthesis, rendering bacteria vulnerable to lysis. However, the emergence of PonA variants with altered binding affinities contributes to resistance against these antibiotics, posing a significant challenge in treating bacterial infections. Furthermore, understanding the structure-function relationship of PonA can provide insights into its enzymatic mechanisms and help identify potential therapeutic targets. Researchers are increasingly interested in the recombinant expression of PonA to investigate its functional properties and interactions with antibiotics. This recombinant protein can be used in high-throughput screening assays to discover new inhibitors or adjuvants that may restore the efficacy of existing antibiotics. Additionally, PonA's role in bacterial physiology makes it a promising candidate for the development of novel antimicrobial strategies. Thus, ongoing studies on PonA recombination and its enzymatic functions are critical in addressing the growing concern of antibiotic resistance and advancing our understanding of bacterial cell wall biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US