Cat: PA1000-5725

Recombinant Human PLTP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PLTP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PLTP;Phospholipid transfer Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55058

  • Expression Region

    19-441aa

  • AA Sequence

    FPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEV KVTELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFLKVYDFLST FITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGIDYSLM KDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSE FFFDSAMESYFRAGALQLLLVGDKVPHDLDMLLRATYFGSIVLLSPAVID SPLKLELRVLAPPRCTIKPSGTTISVTASVTIALVPPDQPEVQLSSMTMD ARLSAKMALRGKALRTQLDLRRFRIYSNHSALESLALIPLQAPLKTMLQI GVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLRE VIEKNRPADVRASTAPTPSTAAV

  • Molecular Weight

    72 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PLTP, or phospholipid transfer protein, is a significant protein implicated in lipid metabolism and lipoprotein metabolism. Research into PLTP has gained momentum due to its critical role in transferring phospholipids between lipoproteins, thereby influencing the composition and functionality of lipoproteins. Dysregulation of PLTP has been associated with various cardiovascular diseases, metabolic disorders, and conditions related to obesity and diabetes, making it a potential target for therapeutic interventions. Additionally, PLTP is involved in the process of high-density lipoprotein (HDL) remodeling, which is essential for cholesterol efflux and reverse cholesterol transport. As a result, understanding the molecular mechanisms underlying PLTP function and its interactions with other proteins and lipids is crucial for developing strategies to modulate its activity. Moreover, researchers are exploring PLTP as a biomarker for lipid-related diseases, which further emphasizes the need for comprehensive studies on its structure, function, and potential implications in health and disease. This ongoing research aims to unravel the complexities of PLTP, providing insights that could lead to novel therapeutic avenues in managing lipid-related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US