Analytical Data
-
Gene name
CABP5
- Application
-
Alternative Names
CABP3; CaBP5; CABP5_HUMAN; Calcium binding Protein 3; Calcium-binding Protein 5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NP86
-
Expression Region
1-173aa
-
AA Sequence
MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR
-
Molecular Weight
19.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CABP5 (Calcium Binding Protein 5) is a member of the calcium-binding protein family that plays a crucial role in regulating cellular processes, particularly in neurons and photoreceptors. Its primary function is to modulate calcium signaling, which is vital for various intracellular pathways including neurotransmitter release and synaptic plasticity. Given the significance of calcium homeostasis in neuronal function and the potential implications in neurodegenerative diseases, the study of CABP5 has garnered increasing interest. Previous research has indicated that CABP5 interacts with key proteins involved in the signaling cascades influenced by calcium levels. The exploration of CABP5 as a recombinant protein aims to elucidate its structural characteristics, functional mechanisms, and potential therapeutic applications. Advances in recombinant technology allow for the production of CABP5 in a host system, facilitating detailed biochemical analyses and functional assays. By understanding CABP5 at the molecular level, researchers can uncover its role in health and disease, providing insights into potential therapeutic strategies for conditions linked to calcium dysregulation, such as Alzheimer's disease and other neurological disorders. Overall, the investigation of CABP5 as a recombinant protein represents a promising avenue for enhancing our understanding of calcium-binding proteins in neurobiology.
