Analytical Data
-
Gene name
RDH8
- Application
-
Alternative Names
RDH8; PRRDH; SDR28C2; Retinol dehydrogenase 8; Photoreceptor outer segment all-trans retinol dehydrogenase; Short chain dehydrogenase/reductase family 28C member 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYR8
-
Expression Region
1-311 aa
-
AA Sequence
MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTLTVAQLDVCSDESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFISLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDVVQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCLSCGCLPTRVRPR
-
Molecular Weight
61.16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RDH8 (Retinol Dehydrogenase 8) is a crucial enzyme involved in the metabolism of retinoids, which are vital for various biological processes, including vision, cellular differentiation, and immune response. Research on RDH8 has gained significant attention due to its role in the visual cycle, particularly in the conversion of retinol to retinaldehyde, a key step in the regeneration of visual pigments in photoreceptor cells. Mutations or dysfunctional expression of RDH8 have been implicated in retinol metabolism disorders and can lead to vision-related pathologies. Moreover, as RDH8 is involved in the oxidative metabolism of retinoids, understanding its function and regulatory mechanisms is essential for elucidating the complexities of retinoid signaling pathways. The production and characterization of RDH8 recombinant protein have become a priority in biochemical research, facilitating the exploration of its enzymatic properties and interaction with various substrates. By employing techniques such as gene cloning, expression in heterologous systems, and purification, researchers are able to study the impact of RDH8 in both normal physiology and disease states. Investigating RDH8's structure-function relationships and its potential as a therapeutic target could pave the way for new interventions in retinoid metabolism disorders, ultimately contributing to advancements in treatments for retinal degenerative diseases and other retinoid-related conditions. As a result, the ongoing research surrounding RDH8 recombinant protein holds promise not only for basic science but also for clinical applications that address crucial aspects of human health.
