Analytical Data
-
Gene name
C9orf9
- Application
-
Alternative Names
C9orf9; Chromosome 9 open reading frame 9; CI009_HUMAN; FLJ26879; Rsb 66 Protein; Rsb66 homolog; Uncharacterized Protein C9orf9
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96E40
-
Expression Region
1-168aa
-
AA Sequence
MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFLDICSELNKLCQHFEAVHSGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHDVVNHLSCDEARNHYGGVVSLIPLILDLMKEWIAHSEKLPRKVLQHGTT
-
Molecular Weight
45.7 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CABC1, a member of the CABC (Cationic Antimicrobial Peptide Binding) protein family, has garnered attention in biological research due to its potential roles in immune response and microbial defense. This protein is implicated in the binding and modulation of cationic antimicrobial peptides (CAMPs), which are crucial components of the innate immune system. The research surrounding CABC1 focuses on its structural features, functional mechanisms, and its interactions with various CAMPs, particularly in the context of bacterial infections and inflammation. Understanding CABC1's role could provide insights into its potential therapeutic applications, such as enhancing host defenses against pathogens or developing novel antimicrobial strategies. Furthermore, as antibiotic resistance persists as a global health challenge, exploring alternative pathways through proteins like CABC1 is increasingly critical. Investigations have aimed to elucidate the recombinant expression of CABC1 to study its properties in vitro, dissecting its biological functions and interactions at a molecular level. This research is pivotal for the advancement of immunological therapies and the development of innovative antimicrobial agents, highlighting the importance of CABC1 within the growing field of host-pathogen interactions and immune modulation.
