Analytical Data
-
Gene name
MAPK13
- Application
-
Alternative Names
MAPK13；PRKM13；SAPK4；Mitogen-activated Protein kinase 13
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15264
-
Expression Region
1-365aa
-
AA Sequence
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
-
Molecular Weight
58.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAPK13, also known as p38 delta MAPK, is a member of the mitogen-activated protein kinase (MAPK) family, which plays a crucial role in various cellular processes, including proliferation, differentiation, and stress responses. Research into MAPK13 has gained traction due to its unique regulatory mechanisms and its involvement in several pathological conditions, such as inflammation, cancer, and neurodegenerative diseases. Unlike other MAPK family members, MAPK13 is predominantly expressed in hematopoietic tissues and displays distinct activation patterns, which suggests specific biological roles that warrant further investigation. Recent studies have highlighted its potential as a therapeutic target due to its differential expression and activity in various disease states. Furthermore, the development of MAPK13 recombinant proteins has become pivotal in elucidating its function and interactions in cellular signaling pathways, offering insights into its role in disease mechanisms and paving the way for novel therapeutic strategies. Understanding the structure and function of MAPK13 could contribute to the development of targeted therapies aimed at modulating its activity, thereby providing new avenues for treating diseases linked to dysregulated MAPK signaling.
