Cat: PA1000-5720

Recombinant Human FAM20C Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FAM20C

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FAM20C;DMP4;Extracellular serine/threonine Protein kinase FAM20C

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8IXL6

  • Expression Region

    93-584aa

  • AA Sequence

    DFSSDPSSNLSSHSLEKLPPAAEPAERALRGRDPGALRPHDPAHRPLLRD PGPRRSESPPGPGGDASLLARLFEHPLYRVAVPPLTEEDVLFNVNSDTRL SPKAAENPDWPHAGAEGAEFLSPGEAAVDSYPNWLKFHIGINRYELYSRH NPAIEALLHDLSSQRITSVAMKSGGTQLKLIMTFQNYGQALFKPMKQTRE QETPPDFFYFSDYERHNAEIAAFHLDRILDFRRVPPVAGRMVNMTKEIRD VTRDKKLWRTFFISPANNICFYGECSYYCSTEHALCGKPDQIEGSLAAFL PDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEEVKQTPPYDSSHRIL DVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRGFGKYSHDELS ILVPLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRGDQVAPVLYQPH LEALDRRLRVVLKAVRDCVERNGLHSVVDDDLDTEHRAASAR

  • Molecular Weight

    66 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FAM20C, or Family with Sequence Similarity 20 Member C, is an essential enzyme involved in the post-translational modification of proteins, particularly through the phosphorylation of specific serine and threonine residues in proteins. This enzyme plays a critical role in the mineralization of bone and teeth by regulating the secretion of matrix proteins that are vital for the formation of extracellular mineralized matrices. The dysfunction of FAM20C has been linked to various skeletal disorders, including amelogenesis imperfecta and autosomal-dominant hypophosphatemic rickets, highlighting its importance in dental and skeletal health. Recent research has focused on understanding the biochemical pathways and mechanisms through which FAM20C influences mineralization processes. The generation of recombinant FAM20C protein has become increasingly significant for studying its structure-function relationship, enzyme kinetics, and interaction with substrate proteins. By utilizing recombinant technology, researchers aim to elucidate its role in biomineralization and explore potential therapeutic interventions for diseases associated with FAM20C deficiency. Understanding the functional properties of FAM20C at the molecular level may also pave the way for novel strategies in regenerative medicine, particularly in the fields of orthopedics and dentistry. Overall, the investigation of recombinant FAM20C holds promise for advancing our comprehension of mineralization processes and developing targeted therapies for related pathologies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US