Analytical Data
-
Gene name
DERP2
- Application
-
Alternative Names
DERP2；DERP2；MICS1；TMBIM5；Growth hormone-inducible transmembrane Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H3K2
-
Expression Region
1-345aa
-
AA Sequence
MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGLSNEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSAIAISRTPVLMNFMMRGSWVTIGVTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVMGAVVAPLTILGGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAMYGGLVLFSMFLLYDTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK
-
Molecular Weight
37.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DERP2, also known as Dermcidin, is a protein that has garnered attention due to its significant role in innate immunity and antimicrobial defense. Found primarily in sweat and sebaceous glands, DERP2 acts as a vital component of the skin's barrier function, protecting against various pathogens. Research indicates that DERP2 exhibits a broad-spectrum antimicrobial activity, making it a subject of interest for therapeutic applications in treating skin infections and inflammatory diseases. Recent studies have focused on the recombinant expression of DERP2 to better understand its structure-function relationship and to explore its potential in biotechnology and medicine. The reconstitution of DERP2 through recombinant DNA technology allows researchers to produce this protein in a controlled environment, facilitating the assessment of its antimicrobial properties and mechanisms of action. Furthermore, understanding DERP2's interactions with microbial agents may lead to novel antimicrobial strategies or the development of new drugs. As skin microbiome research expands, DERP2's role as a defender of skin homeostasis and its implications in diseases such as atopic dermatitis and acne vulgaris continue to illuminate its importance in both basic and applied research contexts. Overall, the study of DERP2 as a recombinant protein holds promise for advancing our knowledge of skin immunity and developing innovative solutions to combat skin-related infections.
