Analytical Data
-
Gene name
C9orf89
- Application
-
Alternative Names
Bcl10 interacting Protein with CARD Protein; Bcl10-interacting CARD Protein; BINCA_HUMAN; BinCARD; C9orf89; Chromosome 9 open reading frame 89
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96LW7
-
Expression Region
1-183aa
-
AA Sequence
MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLGGL
-
Molecular Weight
47 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C9orf90, also known as C9orf90, is a gene located on chromosome 9 that has garnered attention in recent years due to its potential implications in various biological processes and diseases. Research has indicated that C9orf90 may be involved in cellular signaling, and its expression levels have been correlated with numerous physiological and pathological conditions, including cancer and neurodegenerative diseases. The study of C9orf90 recombinant proteins has become increasingly important as they offer a valuable tool for understanding the gene's function, interactions, and implications in disease mechanisms. Recombinant proteins allow for the investigation of the protein's structure, post-translational modifications, and potential interactions with other biomolecules in controlled settings, thereby facilitating the elucidation of its role in cellular pathways. Additionally, C9orf90 has been explored in the context of therapeutic applications, particularly for designing targeted treatments that modulate its activity in disease states. As research continues to unfold, understanding the biological roles and mechanisms of C9orf90 through recombinant proteins will be crucial for uncovering new insights into its significance in health and disease, ultimately paving the way for novel therapeutic strategies.
