Analytical Data
-
Gene name
HWP1
- Application
-
Alternative Names
HWP1；ECE2；Hyphal wall Protein 1
-
Species
Candida albicans
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P46593
-
Expression Region
27-203aa
-
AA Sequence
GQGETEEALIQKRSYDYYQEPCDDYPQQQQQQEPCDYPQQQQQEEPCDYPQQQPQEPCDYPQQPQEPCDYPQQPQEPCDYPQQPQEPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDQPDDNPPIPNIPTDWIPNIPTDWIPDIPEKPTTPATTPNIPA
-
Molecular Weight
21.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HWP1, or Hyphal Wall Protein 1, is a key protein found in various fungi, particularly in the pathogenic species of the Candida genus. Its primary function involves maintaining cell wall integrity during the hyphal growth phase, which is crucial for the virulence of these organisms. Research has shown that HWP1 is involved in adherence and biofilm formation, making it a significant factor in the pathogenicity of Candida albicans, a common cause of opportunistic infections in immunocompromised individuals. The study of HWP1 has garnered attention due to its potential as a therapeutic target; understanding its structure and function can lead to the development of antifungal strategies. Additionally, HWP1 serves as a model for exploring fungal biology, pathogenesis, and host interactions, shedding light on the mechanisms fungi employ to survive and thrive within host environments. Thus, HWP1 research not only aids in combating fungal infections but also enriches our comprehension of fungal physiology and host-pathogen dynamics.
