Cat: PA1000-5703

Recombinant Human AKT3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AKT3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AKT3;PKBG;RAC-gamma serine/threonine-Protein kinase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y243

  • Expression Region

    1-479aa

  • AA Sequence

    MSDVTIVKEGWVQKRGKYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYP LNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTE AIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDY LKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVL KNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRF YGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQD HEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIM RHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPE KYDEDGMDCMDNERRPHFPQFSYSASGRE

  • Molecular Weight

    83 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AKT3, a member of the AKT family of serine/threonine kinases, plays a crucial role in various cellular processes, including cell growth, proliferation, survival, and metabolism. Its dysregulation has been implicated in a variety of diseases, particularly cancer and neurological disorders. Research into AKT3 has gained momentum with the growing understanding of its role in the phosphoinositide 3-kinase (PI3K) signaling pathway, which is often activated in malignancies. The recombinant production of AKT3 protein has become pivotal for studying its biological functions, interactions, and potential as a therapeutic target. Utilizing techniques such as recombinant DNA technology, scientists can produce significant quantities of AKT3 for in vitro studies, allowing for detailed investigations into its enzymatic activity, substrate specificity, and effects on downstream signaling pathways. Furthermore, these studies can help elucidate the molecular mechanisms by which AKT3 contributes to tumorigenesis and neurodevelopmental processes. As a result, understanding the properties of recombinant AKT3 is essential not only for basic research but also for developing targeted therapies that aim to inhibit its activity in diseases where it is overactive. Consequently, the exploration of AKT3 as a therapeutic target offers promising avenues for novel treatments in oncology and beyond, highlighting the importance of obtaining and characterizing the recombinant protein for future studies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US