Analytical Data
-
Gene name
C9orf85
- Application
-
Alternative Names
C9orf85Uncharacterized Protein C9orf85
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96MD7
-
Expression Region
1-157aa
-
AA Sequence
MSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCRPCACELEVCAKCGKKEDIVIPLNKETEKIEHTENNLSSNHRRSCRRNEESDDDLDFDIDLEDTGGDHQMN
-
Molecular Weight
44.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C9orf85, a gene located on chromosome 9, has gained attention in recent years due to its potential role in various cellular processes and its implications in human health. This gene encodes a protein that is thought to be involved in cellular signaling pathways, growth regulation, and possibly mitochondrial function. Studies have shown that alterations in the expression levels of C9orf85 may be associated with certain diseases, including neurodegenerative disorders and cancers. The recombinant protein derived from C9orf85 has been the focus of research to elucidate its biological function and the mechanisms by which it influences cellular behavior. Techniques such as gene cloning, protein expression, and purification are employed to produce this recombinant protein in various expression systems for functional studies. Furthermore, the characterization of C9orf85 protein interactions and its downstream effects can provide insights into its role in pathophysiology and therapeutic potential. Understanding the functional dynamics of C9orf85 is essential for harnessing its applications in biomedical research and developing novel strategies for disease intervention. As research progresses, a clearer picture of C9orf85's significance in health and disease is expected to emerge, highlighting its importance as a target for future therapeutic exploration.
