Analytical Data
-
Gene name
RCE1
- Application
-
Alternative Names
Farnesylated proteins-converting enzyme 2 (FACE-2);Prenyl protein-specific endoprotease 2;RCE1 homolog (hRCE1)
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y256
-
Expression Region
1-329 aa
-
AA Sequence
MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSELPRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVFGAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCVLLERAGDSEAPLCS
-
Molecular Weight
38.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RCE1, or RAS conversion enzyme 1, is an essential membrane-bound endoprotease involved in the maturation of RAS proteins, which play crucial roles in cell signaling pathways that regulate cell growth, differentiation, and survival. The proper functioning of RAS proteins is vital, as their dysregulation is associated with various cancers and other diseases. Research into RCE1 has gained significant attention due to its role in RAS post-translational modifications, particularly in the removal of the C-terminal cysteine that is required for RAS membrane localization and activity. Understanding RCE1's enzymatic mechanism and regulatory pathways has important implications for cancer therapeutics, as targeting RCE1 could potentially disrupt aberrant RAS signaling. Additionally, the study of RCE1's structural and functional properties through the development of recombinant protein would allow for the identification of small molecule inhibitors, offering a promising avenue for drug discovery. The ongoing investigation into RCE1 not only illuminates its fundamental biological functions but also paves the way for novel strategies to combat RAS-driven malignancies. Consequently, RCE1 serves as a critical focus for both basic research and applied biomedical studies.
