Analytical Data
-
Gene name
OSM34
- Application
-
Alternative Names
OSM34；Osmotin-like Protein OSM34
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50700
-
Expression Region
23-244aa
-
AA Sequence
ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCNNPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFCPRSRLGATGSHQLPIKMVTEEN
-
Molecular Weight
44.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OSM34 is a recombinant protein that has emerged as a significant subject of study in the fields of molecular biology and biotechnology. It is derived from a particular organism or cell line known for producing proteins of interest, often involving techniques such as genetic engineering and expression systems. The research surrounding OSM34 focuses on its unique structural and functional properties, which may include its role in specific biological pathways or its potential applications in therapeutics and diagnostics. The increasing interest in recombinant proteins arises from their ability to mimic natural proteins, providing insights into biochemical processes and facilitating the development of targeted treatments for various diseases. Moreover, OSM34's stability and efficacy in different environments make it a valuable candidate for further investigation. Researchers are particularly interested in its interaction with various biomolecules, as well as its potential use in drug delivery systems. This research not only deepens our understanding of protein function at the molecular level but also opens up avenues for innovative therapeutic strategies, particularly in areas where traditional treatments are ineffective. As the demand for novel proteins continues to grow, studies on OSM34 may contribute significantly to advancements in medical and industrial applications, marking a progressive step in the field of biotechnology.
