Analytical Data
-
Gene name
C9orf4
- Application
-
Alternative Names
FRRS1L; C9orf4; DOMON domain-containing Protein FRRS1L; Brain Protein CG-6; Ferric-chelate reductase 1-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P0K9
-
Expression Region
1-194aa
-
AA Sequence
MAKRRAAEPVTFHVPWKRLLLCDFAEQPPPPPLWIRPPGVAHAGQLLGVPEQHRKRKIDAGTMAEPSASPSKRRDSGDNSAPSGQEREDHGLETGDPPLPPPPVLPGPGEELPGARLPGDGGDDGAGRAGPPRGDWGVASCQHNEEFWQYNTFQYWRNPLPPIDLADIEDLSEDTLTEATLQGRNEGAEVDMES
-
Molecular Weight
47.4 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C9orf4 (Chromosome 9 open reading frame 4) is a gene located on chromosome 9 that has garnered significant attention in recent years due to its potential implications in various biological processes and diseases. Originally identified as a novel gene with poorly understood functions, recent studies have highlighted its role in cellular signaling pathways, immune responses, and even neurodegenerative diseases. The protein encoded by C9orf4 is believed to be involved in the regulation of inflammation and cell survival, making it a potential biomarker for conditions such as cancer and autoimmune disorders. Furthermore, its expression levels have been found to correlate with disease progression in certain contexts, prompting researchers to investigate the development of recombinant C9orf4 protein for therapeutic and diagnostic applications. The generation of a recombinant form of this protein allows for detailed studies of its structure and function, facilitating insights into its biological role and interactions with other cellular components. Additionally, as researchers explore the mechanistic pathways influenced by C9orf4, there is a growing interest in leveraging its properties to design innovative treatment strategies. Overall, the study of C9orf4 recombinant protein is situated at the intersection of molecular biology, therapeutic development, and disease research, highlighting its potential as a target for future medical advancements.
