Analytical Data
-
Gene name
wnt8
- Application
-
Alternative Names
wnt8；Protein Wnt-8b
-
Species
Xenopus laevis
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28026
-
Expression Region
23-358aa
-
AA Sequence
AWSVNNFLMTGPKAYLTYSASVAVGAQNGIEECKYQFAWERWNCPESTLQLATHNGLRSATRETSFVHAISSAGVMYTLTRNCSMGDFDNCGCDDSRNGRIGGRGWVWGGCSDNAEFGERISKLFVDGLETGQDARALMNLHNNEAGRLAVKETMKRTCKCHGISGSCSIQTCWLQLAEFRDIGNHLKIKHDQALKLEMDKRKMRSGNSADNRGAIADAFSSVAGSELIFLEDSPDYCLKNISLGLQGTEGRECLQSGKNLSQWERRSCKRLCTDCGLRVEEKKTEIISSCNCKFHWCCTVKCEQCKQVVIKHFCARRERDSNMLNTKRKNRGHRR
-
Molecular Weight
39.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Wnt8 is a member of the Wnt family of secreted glycoproteins that play crucial roles in various biological processes, including cell fate determination, embryonic development, and tissue homeostasis. Its signaling pathway is vital for regulating cell proliferation, differentiation, and migration. Dysregulation of Wnt signaling, including that of Wnt8, has been implicated in various diseases, most notably cancer, where abnormal activation can lead to uncontrolled cell growth. The ability to produce recombinant Wnt8 protein is essential for understanding its biological functions and mechanisms of action in cellular contexts. By studying Wnt8, researchers aim to elucidate its role in developmental biology and its potential as a therapeutic target. Moreover, recombinant Wnt8 can be used in various applications, including in vitro assays, drug screening, and the development of regenerative therapies. Understanding the structure and function of Wnt8 can provide insights into its interactions with receptors, as well as its downstream signaling pathways, making it a significant focus in developmental biology and medicine. Overall, the research on recombinant Wnt8 protein holds promise for advancing our knowledge of cellular signaling and its implications in health and disease.
