Cat: PA1000-5640

Recombinant Human BNIP3L Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BNIP3L

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BNIP3L;BNIP3A;BNIP3H;NIX;BCL2/adenovirus E1B 19 kDa Protein-interacting Protein 3-like

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O60238

  • Expression Region

    43-130aa

  • AA Sequence

    SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSH CDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BNIP3L, also known as BCL2/adenovirus E1B 19 kDa interacting protein 3-like, is a member of the BCL2 family of proteins and plays a crucial role in regulating programmed cell death and autophagy. Research on BNIP3L has gained significant attention due to its involvement in various cellular processes, particularly under stress conditions such as hypoxia and nutrient deprivation. Studies indicate that BNIP3L interacts with mitochondria and modulates mitochondrial dynamics, contributing to cellular survival and death decisions. The protein's dual function in promoting autophagy while inhibiting apoptosis highlights its potential as a therapeutic target in cancer, neurodegenerative diseases, and ischemic injuries. Furthermore, the expression levels of BNIP3L can influence tumorigenesis, with alterations linked to cancer progression and resistance to therapies. Understanding the precise mechanisms by which BNIP3L operates at the molecular level may unveil novel strategies for disease intervention and therapeutic development. As research continues to elucidate the multifaceted roles of BNIP3L, the generation of recombinant BNIP3L proteins will support biochemical studies aimed at characterizing its interactions and functions, potentially leading to insights into how modulation of BNIP3L activity can combat various diseases. Thus, the study of BNIP3L and its recombinant forms is pivotal for advancing our knowledge of cellular homeostasis and disease pathogenesis.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US