Analytical Data
-
Gene name
APE3
- Application
-
Alternative Names
APE3；Aminopeptidase Y
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P37302
-
Expression Region
57-537aa
-
AA Sequence
IPKPHIPYFMKPHVESEKLQDKIKVDDLNATAWDLYRLANYSTPDYGHPTRVIGSKGHNKTMEYILNVFDDMQDYYDVSLQEFEALSGKIISFNLSDAETGKSFANTTAFALSPPVDGFVGKLVEIPNLGCEEKDYASVVPPRHNEKQIALIERGKCPFGDKSNLAGKFGFTAVVIYDNEPKSKEGLHGTLGEPTKHTVATVGVPYKVGKKLIANIALNIDYSLYFAMDSYVEFIKTQNIIADTKHGDPDNIVALGAHSDSVEEGPGINDDGSGTISLLNVAKQLTHFKINNKVRFAWWAAEEEGLLGSNFYAYNLTKEENSKIRVFMDYDMMASPNYEYEIYDANNKENPKGSEELKNLYVDYYKAHHLNYTLVPFDGRSDYVGFINNGIPAGGIATGAEKNNVNNGKVLDRCYHQLCDDVSNLSWDAFITNTKLIAHSVATYADSFEGFPKRETQKHKEVDILNAQQPQFKYRADFLII
-
Molecular Weight
58.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APE3 (apurinic/apyrimidinic endonuclease 3) is a crucial member of the apurinic/apyrimidinic (AP) endonuclease family, involved in the base excision repair (BER) pathway that maintains genomic stability by repairing damaged DNA. The interest in APE3 research stems from its dual functionality: it not only cleaves abasic sites in DNA but also possesses 3' to 5' exonuclease activity, which enhances the fidelity of DNA repair processes. Dysregulation of APE3 has been implicated in various cancers and other diseases, making it a potential biomarker and therapeutic target. Recent studies have highlighted its role in cellular responses to oxidative stress and DNA damage, revealing its significance in cancer biology and potential implications in aging. Moreover, APE3's involvement in drug resistance has garnered attention in the context of cancer treatment, prompting investigations into its inhibition as a strategy to enhance the efficacy of chemotherapeutic agents. Understanding APE3’s structure-function relationship through recombinant protein studies could facilitate the development of novel inhibitors and therapies, addressing the challenges in combating drug-resistant tumors and improving patient outcomes. The ongoing research into APE3 not only provides insights into fundamental mechanisms of DNA repair but also opens avenues for clinical applications in oncology and regenerative medicine.
