Analytical Data
-
Gene name
cwlM
- Application
-
Alternative Names
cwlM；N-acetylmuramoyl-L-alanine amidase CwlM
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P37134
-
Expression Region
1-253aa
-
AA Sequence
MVKIFIDPGHGGSDTGASANGLQEKQLTLQTALALRNMLLNEYQNVSVLLSRTSDQTVSLTQRTNAANSWGADYFLSIHMNAGGGTGFEDYIYPGVGAPTTTYRDIMHEEILKVVDFRDRGKKTANFHVLRETAMPALLTENGFVDNTNDAEKLKSSAFIQSIARGHANGLARAFNLSKNAAALYKVQIAAFRTKANADSLAAQAEAKGFDALVIYRDSLYKVQIGAFSSKENAEALVQQAKNAEFDTFIYQE
-
Molecular Weight
43.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CWL-M, or Cell Wall Layer M, is a recombinant protein derived from the cell walls of certain bacteria, particularly Gram-positive organisms. The study of CWL-M is significant due to its potential applications in biotechnology and medicine. This protein plays a critical role in the formation and maintenance of the bacterial cell wall, which is vital for bacterial stability and integrity. Understanding the structure and function of CWL-M can provide insights into bacterial physiology and pathogenesis, paving the way for the development of new antibiotics or biotherapeutics. Additionally, recombinant techniques allow for the production of CWL-M in controlled environments, enabling researchers to investigate its properties and interactions with other biological molecules. By expressing CWL-M in heterologous systems, scientists can also explore its use as an adjuvant in vaccine development or as a tool in molecular biology for protein purification. The growing interest in CWL-M reflects its importance in advancing our knowledge of bacterial biology and its potential utility in various fields, including drug development, infectious disease treatment, and synthetic biology.
