Analytical Data
-
Gene name
C9orf23
- Application
-
Alternative Names
RPP25L; C9orf23; Ribonuclease P Protein subunit p25-like Protein; RNase P Protein subunit-like p25; Rpp25-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N5L8
-
Expression Region
1-163aa
-
AA Sequence
MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
-
Molecular Weight
44 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C9orf23, located on chromosome 9, is a gene that has garnered interest due to its potential involvement in various cellular processes and its implications in human diseases. Although its exact function remains largely enigmatic, studies suggest that C9orf23 might play a role in regulating cellular metabolism and signal transduction pathways. Recent research has indicated a possible association between C9orf23 and neurodegenerative diseases, particularly amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD), where repeated expansions in nearby genes can lead to neurotoxicity. Consequently, C9orf23 has been hypothesized to interact with these pathogenic mechanisms, making it a significant target for understanding disease etiology and progression. The recombinant protein of C9orf23 is being explored for its structural characteristics and functional properties, which could provide insights into its biological role and therapeutic potential. Understanding the molecular biology and functions of C9orf23 is vital, as it could lead to the development of novel diagnostic and therapeutic strategies for neurodegenerative disorders and contribute to the broader field of genomics and proteomics. As researchers continue to characterize the recombinant protein, there is hope that this work will unveil critical aspects of C9orf23's involvement in human health and disease.
