Analytical Data
-
Gene name
entC2
- Application
-
Alternative Names
entC2；Enterotoxin type C-2
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P34071
-
Expression Region
28-266aa
-
AA Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
-
Molecular Weight
27.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EntC2 is a recombinant protein that has garnered significant attention in the field of biotechnology and molecular biology due to its role in iron acquisition mechanisms in various microorganisms. As part of the enterobactin biosynthetic pathway, EntC2 is involved in the synthesis of catecholate siderophores, which are crucial for microbial survival in iron-limited environments. The exploration of EntC2 provides insights into microbial iron metabolism, which is essential for understanding pathogenicity, particularly in bacteria that cause infections in humans. The research on EntC2 emphasizes its potential applications in developing novel antimicrobial strategies by targeting iron acquisition systems. Furthermore, recombinant production of EntC2 allows for detailed structural and functional studies, enabling the characterization of its enzymatic activity and interaction with other biosynthetic components. This research lays the groundwork for innovative biotechnological applications, including the design of iron-binding agents that can mitigate the effects of iron deficiency or be used in medical therapeutics against bacterial infections. Overall, the investigation of EntC2's structure and function not only enriches fundamental biological knowledge but also opens new avenues for developing therapeutic strategies in an era where antimicrobial resistance is a growing concern.
