Analytical Data
-
Gene name
C9orf163
- Application
-
Alternative Names
C9orf163Uncharacterized Protein C9orf163
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N9P6
-
Expression Region
1-203aa
-
AA Sequence
MPGPLTCTPAWQGQGRAAAFLCCSFQRAGAVVGVPARWHRGRLSSQQRLRSSLGGSHPCPQLGRRLVREGVISVPRQQGRRRCRESFSPADVAPGPICSANICLSGVRFLTCLNRVREHVVGPSPSPAAPICFFPVVEALCTLRGRRCHCLPFPKRGMQRWMLPLRRGARLLPLASSKNPRARSPGLDPLGSSETLWSHRGGH
-
Molecular Weight
48.6 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C9orf163, a gene located on chromosome 9, encodes a protein of interest due to its potential implications in various cellular processes and human diseases. Research has demonstrated that the C9orf163 protein may play a role in the regulation of immune responses and cellular signaling pathways. Its involvement in critical biological functions has sparked interest in understanding its structure and functional characteristics, especially in relation to disorders like neurodegenerative diseases and certain cancers. Scientists are particularly focused on elucidating the protein's interactions within cellular networks and its possible contribution to disease mechanisms. By studying the recombinant form of C9orf163, researchers aim to gain insights into its biological role and therapeutic potentials, potentially leading to the development of novel strategies for disease intervention. Additionally, recombinant protein production allows for detailed biochemical studies, including the assessment of post-translational modifications, protein folding, and stability, which are crucial for elucidating its functional properties. Overall, the study of C9orf163 and its recombinant protein is a promising avenue in molecular biology and translational medicine, with the potential to uncover new targets for therapeutic intervention.
