Analytical Data
-
Gene name
fkpA
- Application
-
Alternative Names
fkpA；yzzS；FKBP-type peptidyl-prolyl cis-trans isomerase FkpA
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P45523
-
Expression Region
26-270aa
-
AA Sequence
AEAAKPATAADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK
-
Molecular Weight
33.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FKPA, or FK506-binding protein A, is a member of the immunophilin family, which plays crucial roles in protein folding, trafficking, and regulation of intracellular signaling pathways. Studies have shown that FKPA is involved in several physiological processes, including immune response and cellular stress responses. Its ability to bind to immunosuppressive compounds like FK506 has made it a focal point in research related to transplantation and autoimmune diseases. The interest in FKPA recombinant protein arises from its multifunctionality and potential therapeutic applications. By expressing FKPA as a recombinant protein, researchers aim to gain insights into its structure-function relationships, elucidate its interactions with various binding partners, and identify its role in cellular mechanisms. Recombinant studies can also pave the way for the development of novel drugs that target FKPA or its pathways, presenting opportunities for innovative treatments in immunology and other biomedical fields. Furthermore, understanding FKPA's biochemical properties could aid in the design of more effective strategies for modulating immune responses in clinical settings. Overall, FKPA recombinant protein research is critical for advancing our knowledge of cellular regulation and developing targeted therapies for diverse diseases.
