Analytical Data
-
Gene name
CD59A
- Application
-
Alternative Names
CD59A；Cd59；CD59A glycoProtein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13987
-
Expression Region
26-102aa
-
AA Sequence
MASMTGGQQMGRGHHHHHHGNLYFQGGEFALVQCYNCPNPTADCKTAVNC SSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLC NFNEQLEN
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD59A, a member of the complement regulatory protein family, plays a crucial role in the immune system by preventing the formation of the membrane attack complex (MAC) and protecting host cells from complement-mediated lysis. Its function is particularly significant in various pathological conditions, including autoimmune diseases, cancer, and viral infections, where dysregulation of complement activity can lead to tissue damage. In recent years, research has focused on the therapeutic potential of CD59A, exploring its role in modulating immune responses and as a potential target for drug development. The recombinant expression of CD59A protein allows for detailed studies on its structure-function relationships, the molecular mechanisms underlying its protective effects, and its interactions with complement components. Such studies aim to elucidate how CD59A can be harnessed to create innovative therapies, particularly for diseases characterized by excessive complement activation. By producing and analyzing recombinant CD59A, researchers can gain insights into its biological activities and therapeutic applications, paving the way for new strategies to regulate complement-mediated damage in various diseases. This research is critical for advancing our understanding of immunological processes and developing new treatments that can improve patient outcomes.
