Analytical Data
-
Gene name
SUS1
- Application
-
Alternative Names
SUS1；KIAA0797；SSP1；SUSP1；Sentrin-specific protease 6
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31925
-
Expression Region
1-218aa
-
AA Sequence
ARLDRVKNMTGPVEISGKKARLRELANPVIVAGDHGKESKDRDEAEEQGGFKKMYSLIDDYKFKGHIRLISAQMNRVRNGELYQYICDTKGAFVQPAYEAFRLDCDRVHEVRSAKDRDLPWRPCEIIADGVSGLHIDPYHSDKDADILVNFFDKCNADPSYWDEISQGGQRIYEKYTWKLYSERLMTLTGAYGFWNYVSKLERGDTRYIDMFYALEYP
-
Molecular Weight
41.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SUS1, a crucial component of the transcription machinery, plays a vital role in various cellular processes, including RNA processing and gene regulation. It is part of the Sus1-Paf1 complex, which links transcription elongation to RNA processing and is essential for the maturation of mRNA. Research on SUS1 has gained momentum due to its implications in understanding the mechanisms of gene expression and its potential involvement in disease pathways, including cancer and genetic disorders. The study of SUS1 recombinant proteins has provided insights into its structural properties, interaction dynamics with other proteins, and functional roles within the cell. By utilizing recombinant DNA technology, researchers can produce SUS1 in a controlled laboratory environment, facilitating in-depth analysis of its biochemical properties and functional mechanisms. This research not only enhances our understanding of fundamental biological processes but also opens avenues for therapeutic interventions targeting aberrant gene expression linked to SUS1 dysfunction. Ultimately, investigations into SUS1 and its recombinant forms contribute to a broader comprehension of transcription regulation and its implications in health and disease.
