Analytical Data
-
Gene name
C7orf36
- Application
-
Alternative Names
YAE1; C7orf36; YAE1D1; GK003; Protein YAE1 homolog; Yae1 domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NRH1
-
Expression Region
1-226aa
-
AA Sequence
MSWVQAASLIQGPGDKGDVFDEEADESLLAQREWQSNMQRRVKEGYRDGIDAGKAVTLQQGFNQGYKKGAEVILNYGRLRGTLSALLSWCHLHNNNSTLINKINNLLDAVGQCEEYVLKHLKSITPPSHVVDLLDSIEDMDLCHVVPAEKKIDEAKDERLCENNAEFNKNCSKSHSGIDCSYVECCRTQEHAHSENPSPTWILEQTASLVKQLGLSVDVLQHLKQL
-
Molecular Weight
51.7 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C7orf36, also known as Chromosome 7 Open Reading Frame 36, has garnered attention in recent years due to its potential involvement in various biological processes and its implications in human health. Located on chromosome 7, this gene encodes a protein that is thought to play a role in cellular functions, although its exact mechanisms remain largely unexplored. Research indicates that C7orf36 may be implicated in cellular signaling pathways, possibly influencing processes such as cell proliferation, differentiation, and response to stress. Additionally, preliminary studies suggest that mutations or dysregulation of C7orf36 could be linked to certain diseases, thereby making it a potential biomarker for diagnostic purposes or a target for therapeutic intervention. The recombinant protein of C7orf36 is being studied to elucidate its structure-function relationship, which could provide insights into its biological roles and how alterations in its function contribute to disease pathology. Understanding the function of C7orf36 at the protein level is crucial for exploring its potential applications in medicine, including its involvement in cancer and other pathological conditions. Thus, studies involving C7orf36 recombinant protein represent a promising area of research that could enhance our understanding of gene function and open new avenues for targeted therapies.
