Analytical Data
-
Gene name
ctfB
- Application
-
Alternative Names
ctfB；Acetoacetyl-CoA:acetate/butyrate CoA-transferase beta subunit
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23673
-
Expression Region
1-221aa
-
AA Sequence
MINDKNLAKEIIAKRVARELKNGQLVNLGVGLPTMVADYIPKNFKITFQSENGIVGMGASPKINEADKDVVNAGGDYTTVLPDGTFFDSSVSFSLIRGGHVDVTVLGALQVDEKGNIANWIVPGKMLSGMGGAMDLVNGAKKVIIAMRHTNKGQPKILKKCTLPLTAKSQANLIVTELGVIEVINDGLLLTEINKNTTIDEIRSLTAADLLISNELRPMAV
-
Molecular Weight
30.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of CTFB (C-terminal-binding protein) recombinant proteins has gained significant attention due to their crucial roles in various biological processes, including gene regulation, cellular signaling, and development. CTFB proteins function as transcriptional co-repressors, interacting with a variety of transcription factors and mediating the repression of target genes. Their involvement in critical pathways has implications for understanding developmental disorders and diseases such as cancer. The ability to produce recombinant CTFB proteins in vitro allows researchers to investigate their structural properties, functional mechanisms, and interactions with other molecular partners. Moreover, studying these proteins can shed light on the regulatory networks in which they operate and open avenues for therapeutic interventions. The advancement of recombinant DNA technology and protein expression systems has made it feasible to generate large quantities of CTFB proteins, facilitating biochemical assays, structural studies, and potential drug discovery efforts. Understanding the complexities of CTFB function could lead to novel insights into cellular regulation and contribute to the development of targeted therapies for diseases associated with CTFB dysregulation.
