Analytical Data
-
Gene name
h1f0-a
- Application
-
Alternative Names
h1f0-a；
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22845
-
Expression Region
1-194aa
-
AA Sequence
MTENSAPAAKPRRSKASKKSTDHPKYSDMILDAVQAEKSRSGSSRQSIQKYIKNNYTVGENADSQIKLSIKRLVTSGTLKQTKGVGASGSFRLAKADEVKKPAKKPKKEIKKAVSPKKAAKPKKAAKSPAKAKKPKVAEKKVKKAPKKKPAPSPRKAKKTKTVRAKPVWASKAKKAKPSKPKAKASPKKSGRKK
-
Molecular Weight
37.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The H1F0-A protein, a member of the histone family, plays a crucial role in the regulation of gene expression and chromatin structure. Research into H1F0-A has gained momentum due to its involvement in various cellular processes, including DNA compaction, transcriptional regulation, and responses to environmental stress. Notably, alterations in histone proteins, particularly H1 variants, have been implicated in numerous diseases, including cancer. Understanding the functional dynamics of H1F0-A is essential for elucidating its specific contributions to chromatin architecture and gene regulation. Additionally, studies have shown that H1F0-A may influence cellular differentiation and proliferation, highlighting its potential as a therapeutic target. Investigations often focus on the molecular mechanisms by which H1F0-A interacts with other proteins and nucleic acids, as well as its post-translational modifications, which can affect its stability and function. Furthermore, research is exploring the role of H1F0-A in the context of epigenetic modifications, providing insights into how these changes are linked to cellular identity and disease states. Overall, the research background of H1F0-A underscores its significance in epigenetics and gene regulation, paving the way for further exploration of its potential therapeutic applications.
