Analytical Data
-
Gene name
C6orf33
- Application
-
Alternative Names
PAQR8; C6orf33; LMPB1; MPRB; Membrane progestin receptor beta; mPR beta; Lysosomal membrane Protein in brain 1; Membrane progesterone P4 receptor beta; Membrane progesterone receptor beta; Progesterone and adipoQ receptor family member 8; Progestin and adipoQ receptor family member 8; Progestin and adipoQ receptor family member VIII
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TEZ7
-
Expression Region
1-354aa
-
AA Sequence
MTTAILERLSTLSVSGQRLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFLPAAAFCGWLSCAGCCYAKYCYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS
-
Molecular Weight
64.68 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C6orf33, also known as chromosome 6 open reading frame 33, is a gene located on human chromosome 6, and it has garnered interest in the field of molecular biology and genetics due to its potential implications in various biological processes and diseases. Initial studies suggested that C6orf33 may play a role in cell signaling and immune responses, which has led to investigations into its function in different tissue types. Recent research has focused on the characterization of C6orf33 recombinant proteins, which are essential for understanding the gene's function and mechanisms. These studies involve the expression and purification of the C6orf33 protein in various systems, such as bacterial or mammalian cells, allowing for functional assays to determine its biological roles. The exploration of C6orf33's involvement in diseases, particularly in cancer and autoimmune disorders, highlights the significance of this gene in health and disease. By elucidating the functional properties of the C6orf33 recombinant protein, researchers aim to uncover novel therapeutic targets and biomarkers, fostering advancements in medical research and potential clinical applications. This burgeoning area of research emphasizes the importance of C6orf33 in the broader context of genomic studies and its therapeutic potential.
