Analytical Data
-
Gene name
C6orf48
- Application
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBA6
-
Expression Region
1-37aa
-
AA Sequence
MRVVMARLLSEGEQGIPTACAAFAQQPAGGHVAAWLG
-
Molecular Weight
29.7 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C6orf48, also known as Chromosome 6 Open Reading Frame 48, is a gene that encodes a protein whose precise biological functions remain largely unexplored. Recent studies have suggested that C6orf48 may play a role in cellular processes such as cell proliferation and apoptosis, making it a potential candidate for investigation in various pathological conditions, including cancer and neurodegenerative diseases. Researchers are increasingly interested in the recombinant expression of C6orf48 to elucidate its functional characteristics and understand its interaction with other cellular components. Recombinant protein techniques enable the production of C6orf48 in various expression systems, facilitating detailed biochemical analyses and functional assays. Understanding the structure-function relationship of this protein could provide insights into its role in health and disease, potentially leading to novel therapeutic targets. As our knowledge of C6orf48 expands, it may reveal new pathways involved in disease mechanisms and open avenues for innovative diagnostic and treatment strategies. Thus, the study of C6orf48 recombinant protein remains a promising area of focus in molecular biology and biomedicine.
