Cat: PA2000-6319

Recombinant Human C6orf48 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C6orf48

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UBA6

  • Expression Region

    1-37aa

  • AA Sequence

    MRVVMARLLSEGEQGIPTACAAFAQQPAGGHVAAWLG

  • Molecular Weight

    29.7 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C6orf48, also known as Chromosome 6 Open Reading Frame 48, is a gene that encodes a protein whose precise biological functions remain largely unexplored. Recent studies have suggested that C6orf48 may play a role in cellular processes such as cell proliferation and apoptosis, making it a potential candidate for investigation in various pathological conditions, including cancer and neurodegenerative diseases. Researchers are increasingly interested in the recombinant expression of C6orf48 to elucidate its functional characteristics and understand its interaction with other cellular components. Recombinant protein techniques enable the production of C6orf48 in various expression systems, facilitating detailed biochemical analyses and functional assays. Understanding the structure-function relationship of this protein could provide insights into its role in health and disease, potentially leading to novel therapeutic targets. As our knowledge of C6orf48 expands, it may reveal new pathways involved in disease mechanisms and open avenues for innovative diagnostic and treatment strategies. Thus, the study of C6orf48 recombinant protein remains a promising area of focus in molecular biology and biomedicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US