Analytical Data
-
Gene name
C6orf25
- Application
-
Alternative Names
MPIG6B; C6orf25; G6B; G6B-B; Megakaryocyte and platelet inhibitory receptor G6b; Protein G6b
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95866
-
Expression Region
1-237aa
-
AA Sequence
MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRFALSPPHSSTCENRAPEASKGGRAQDSRGPGPGTEPALCGSGPSSPQQAPPAVHSGPC
-
Molecular Weight
51.4 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C6orf25, also known as the chromosome 6 open reading frame 25, has garnered attention in recent years due to its potential roles in various biological processes and disease mechanisms. Initially identified through genomic studies, C6orf25 is located on chromosome 6 and is believed to be involved in cellular pathways related to cell proliferation, differentiation, and apoptosis. Research has suggested that alterations in the expression of C6orf25 may be linked to several conditions, including cancer and autoimmune diseases. As a result, scientists are increasingly focusing on the characterization of C6orf25 and its protein product. The production of recombinant C6orf25 protein allows for detailed investigations into its functional properties, interactions with other biomolecules, and its potential as a therapeutic target. Understanding the biochemical characteristics of C6orf25 is crucial for elucidating its role in health and disease, and ongoing research aims to provide insights that could lead to novel diagnostic or therapeutic strategies.
