Analytical Data
-
Gene name
acm
- Application
-
Alternative Names
acm;Muscarinic acetylcholine receptor M1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25310
-
Expression Region
78-294aa
-
AA Sequence
DTSGVQGIDVSHWQGSINWSSVKSAGMSFAYIKATEGTNYKDDRFSANYTNAYNAGIIRGAYHFARPNASSGTAQADYFASNGGGWSRDNRTLPGVLDIEHNPSGAMCYGLSTTQMRTWINDFHARYKARTTRDVVIYTTASWWNTCTGSWNGMAAKSPFWVAHWGVSAPTVPSGFPTWTFWQYSATGRVGGVSGDVDRNKFNGSAARLLALANNTA
-
Molecular Weight
30.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACM (Arachnocrotalin-like Cardiotoxin Modulator) recombinant proteins are a focus of research due to their unique properties and potential applications in pharmacology and biotechnology. These proteins are derived from the venom of certain snake species, which are known for their complex mixture of bioactive components. ACM proteins exhibit a range of biological activities, including neurotoxicity and cardiotoxicity, making them valuable for studying cellular signaling pathways and toxin-receptor interactions. Researchers aim to harness these proteins for therapeutic purposes, such as developing novel analgesics or neuroprotective agents. Furthermore, advancements in recombinant DNA technology have enabled the production of these proteins in vitro, providing a more sustainable and ethical source compared to traditional extraction methods from venomous snakes. The ability to modify these proteins through genetic engineering also opens up avenues for enhancing their efficacy and specificity. Consequently, the study of ACM recombinant proteins is pivotal in understanding their mechanisms of action and exploring their potential in drug development, making them a significant area of interest within the fields of molecular biology and medicinal chemistry.











