Analytical Data
-
Gene name
C4orf16
- Application
-
Alternative Names
AP1AR; C4orf16; PRO0971AP-1 complex-associated regulatory Protein; 2c18; Adaptor-related Protein complex 1-associated regulatory Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q63HQ0
-
Expression Region
1-269aa
-
AA Sequence
MGNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIVDLRERHYDSIAEKQKDLDKKIQKEQERQRIVQQYHPSNNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYSNKETGSNPTSASDDSNGLEWENDFVSAEMDDNGNSEYSGFVNPVLELSDSGIRHSDTDQQTR
-
Molecular Weight
56.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C4orf16, also known as Chromosome 4 Open Reading Frame 16, is a protein-coding gene that has garnered interest in the field of molecular biology and genetics due to its potential roles in various physiological processes and diseases. Initially identified through genomic sequencing efforts, C4orf16 has been implicated in several cellular functions, including cell signaling, apoptosis, and possibly immune responses. Recent studies have suggested that aberrations in C4orf16 expression or function may be associated with certain pathological conditions, such as cancer and autoimmune disorders. The recombinant protein form of C4orf16 is increasingly being produced in laboratory settings to facilitate detailed investigations into its structure and function. By leveraging techniques such as recombinant DNA technology, researchers aim to analyze the biochemical properties of C4orf16, explore its interaction with other proteins, and determine its functional relevance in different biological contexts. Understanding the role of C4orf16 at the molecular level could provide insights into its contribution to human health and disease, paving the way for potential therapeutic applications. As research progresses, the characterization of C4orf16 and its recombinant protein may contribute significantly to our overarching understanding of genetic regulation and protein interactions within the cell.
