Analytical Data
-
Gene name
AC1
- Application
-
Alternative Names
AC1；AACT；Alpha-1-antichymotrypsin
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14982
-
Expression Region
1-358aa
-
AA Sequence
MRTPRFRIQAKNVFLTYPKCSIPKEHLLSFIQTLSLQSNPKFIKICRELHQNGEPHLHALIQFEGKITITNNRLFDCVHPSCSTSFHPNIQGAKSSSDVKSYLDKDGDTVEWGQFQIDGRSARGGQQSANDAYAKALNSGSKSEALNVIRELVPKDFVLQFHNLNSNLDRIFQEPPAPYVSPFPCSSFDQVPVEIEEWVADNVRDSAARPWRPNSIVIEGDSRTGKTIWARSLGPHNYLCGHLDLSPKVFNNAAWYNVIDDVDPHYLKHFKEFMGSQRDWQSNTKYGKPVQIKGGIPTIFLCNPGPTSSYKEFLAEEKQEALKAWALKNAIFITLTEPLYSGSNQSHSQTSQEASHPA
-
Molecular Weight
42.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AC1 recombinant protein research is centered on understanding the role of AC1, which is an adenylate cyclase implicated in various physiological processes, including signal transduction and cellular communication. Found predominantly in certain pathogens, AC1 is known to modulate host immune responses, which makes it a critical target for both therapeutic and vaccine development. The study of AC1 recombinant proteins allows researchers to dissect its structure-function relationships and create specific inhibitors or immune responses against it. Additionally, the use of recombinant DNA technology facilitates the production of AC1 in heterologous systems, which provides ample quantities for biochemical and biophysical studies. As researchers investigate the potential of AC1 through structural analysis and functional assays, they aim to clarify its mechanisms of action, revealing how it influences host-pathogen interactions. This knowledge could lead to novel strategies for combating infectious diseases, enhancing vaccine efficacy, and elucidating the underlying molecular pathways involved in diseases associated with dysregulated AC1 activity. Overall, the exploration of AC1 recombinant proteins stands at the intersection of molecular biology and immunology, promising significant advances in our understanding of pathogen biology and the development of innovative therapeutic approaches.
