Analytical Data
-
Gene name
eutC
- Application
-
Alternative Names
eutC；Ethanolamine ammonia-lyase small subunit
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P19636
-
Expression Region
1-295aa
-
AA Sequence
MDQKQIEEIVRSVMASMGQAAPAPSEAKCATTNCAAPVTSESCALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR
-
Molecular Weight
35.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EutC, a key enzyme in the ethanolamine utilization (Eut) pathway, plays a pivotal role in the metabolism of ethanolamine, which is an important nitrogen source for various microorganisms. Research on EutC is significant due to its involvement in microbial growth and the potential applications in biotechnology and environmental science. Understanding the structure and function of EutC can provide insights into bacterial adaptation mechanisms in nutrient-limited environments. Additionally, studying EutC can lead to advancements in synthetic biology, where engineered microorganisms could be designed for bioremediation or biofuel production using ethanolamine as a substrate. The recombinant production of EutC protein in heterologous systems, such as E. coli, allows for the detailed analysis of its biochemical properties and catalytic mechanisms. Approaches like site-directed mutagenesis and structural biology techniques, including X-ray crystallography and NMR spectroscopy, can unravel its active site configuration and interaction with substrates. As the demand for sustainable processes grows, EutC's potential role in metabolic engineering and its applications in biotechnological innovations underscore the importance of this research area in microbiology and environmental biotechnology.
