Analytical Data
-
Gene name
C22orf23
- Application
-
Alternative Names
C22orf23UPF0193 Protein EVG1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZE7
-
Expression Region
1-217aa
-
AA Sequence
MASQKQMEVVTKGTGFRRRPKTITYTPGTCELLRVMMKESKLTNIQQRHIMDIMKRGDALPLQCSPTSSQRVLPSKQIASPIYLPPILAARPHLRPANMCQANGAYSREQFKPQATRDLEKEKQRLQNIFATGKDMEERKRKAPPARQKAPAPELDRFEELVKEIQERKEFLADMEALGQGKQYRGIILAEISQKLREMEDIDHRRSEELRKGLATT
-
Molecular Weight
50.27 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C22orf23, also known as chromosome 22 open reading frame 23, is a gene located on human chromosome 22, which has gained attention due to its potential implications in various biological processes and diseases. Despite its identification, the functional roles of C22orf23 remain largely unexplored, prompting researchers to investigate its expression patterns and biological significance. Preliminary studies suggest that C22orf23 may be involved in cellular mechanisms such as apoptosis, proliferation, and stress responses, which could link it to conditions like cancer and genetic disorders. The recombinant protein of C22orf23 provides a crucial tool for elucidating its mechanistic pathways and interactions within cellular contexts. By producing and characterizing this protein, researchers aim to uncover its structural properties, post-translational modifications, and interaction networks. Furthermore, understanding the function of C22orf23 through its recombinant form may contribute to the identification of novel therapeutic targets and biomarkers for diseases associated with its dysregulation. Given the increasing interest in the role of lesser-studied genes in human health, C22orf23 represents a promising area of research with the potential to provide insights into complex biological systems and enhance our understanding of gene function in health and disease.
