Analytical Data
-
Gene name
mrkA
- Application
-
Alternative Names
mrkA;Probable serine/threonine-Protein kinase MARK-A
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12267
-
Expression Region
23-202aa
-
AA Sequence
ADTNVGGGQVNFFGKVTDVSCTVSVNGQGSDANVYLSPVTLTEVKAAAADTYLKPKSFTIDVSDCQAADGTKQDDVSKLGVNWTGGNLLAGATAKQQGYLANTEAAGAQNIQLVLSTDNATALTNKIIPGDSTQPKAAGDASAVQDGARFTYYVGYATSTPTTVTTGVVNSYATYEITYQ
-
Molecular Weight
20.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the recombinant protein MrkA has garnered significant attention due to its crucial role in the pathogenicity of certain bacterial strains, particularly in the context of urinary tract infections (UTIs) caused by uropathogenic Escherichia coli (UPEC). MrkA is a component of the type 1 pili, which facilitate bacterial adherence to the urinary tract epithelium, thereby promoting colonization and persistence. Understanding the structure and function of MrkA is essential for elucidating the mechanisms of microbial virulence and host-pathogen interactions. Furthermore, research into MrkA has potential implications for the development of novel therapeutic strategies and vaccines aimed at preventing UTIs. By exploring the recombinant expression of MrkA, scientists aim to produce it in a controlled laboratory setting, allowing for in-depth studies of its biochemical properties, immunogenicity, and interactions with host cells. This research could lead to advancements in diagnostic tools and therapeutic approaches to combat infections caused by multidrug-resistant bacterial strains, contributing to global health efforts to manage and prevent bacterial infections effectively.











