Analytical Data
-
Gene name
Pka-C1
- Application
-
Alternative Names
Pka-C1；PKACA；cAMP-dependent Protein kinase catalytic subunit alpha
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12370
-
Expression Region
2-353aa
-
AA Sequence
GNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
-
Molecular Weight
56.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Pka-C1, or Protein kinase A catalytic subunit 1, is a key enzyme involved in the cAMP-dependent signaling pathway, which plays a crucial role in various cellular processes such as metabolism, gene expression, and cell proliferation. The research background of Pka-C1 focuses on understanding its structure-function relationships, regulatory mechanisms, and the implications of its dysregulation in diseases. Abnormal Pka-C1 activity has been linked to several pathological conditions, including cancer, heart diseases, and neurodegenerative disorders, making it a significant target for therapeutic interventions. Recent advances in recombinant protein technology have enabled the efficient production and purification of Pka-C1, facilitating detailed biochemical studies and structure determination through techniques such as X-ray crystallography and NMR spectroscopy. Researchers are particularly interested in the development of specific inhibitors that could modulate Pka-C1 activity, advancing our understanding of its biological roles and potential as a drug target. As a result, Pka-C1 continues to be a subject of intense investigation in the fields of biochemistry, pharmacology, and molecular biology, with the aim of elucidating its function in health and disease.
