Analytical Data
-
Gene name
C21orf56
- Application
-
Alternative Names
SPATC1L; C21orf56; Speriolin-like Protein; Spermatogenesis and centriole-associated Protein 1-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H0A9
-
Expression Region
1-186aa
-
AA Sequence
MVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDARVVGEIAFQLDRRILAYVFPGVTRLYGFTVANIPEKIEQTSTKSLDGSVDERKLRELTQRYLALSARLEKLGYSRDVHPAFSEFLINTYGILKQRPDLRANPLHSSPAALRKLVIDVVPPKFLGDSLLLLNCLCELSKEDGKPLFAW
-
Molecular Weight
47.4 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C21orf56, also known as Chromosome 21 open reading frame 56, is a protein-coding gene located on human chromosome 21. Research on C21orf56 has gained interest due to its potential implications in various physiological and pathological processes. It is believed to play a role in brain development and function, making it a candidate for studies related to neurodevelopmental disorders, including Down syndrome, which is caused by trisomy of chromosome 21. Additionally, C21orf56 has been implicated in cellular mechanisms such as apoptosis and cell signaling, which are crucial for maintaining homeostasis and responding to stress. Recombinant C21orf56 protein has been produced for functional studies to better understand its biological roles and interactions within cellular pathways. Investigating this protein may provide insights into the molecular underpinnings of diseases associated with chromosome 21 and could aid in the development of targeted therapies. Overall, the study of C21orf56 and its recombinant forms offers a promising avenue for unraveling the complexities of its functions and contributions to human health.
