Analytical Data
-
Gene name
insE1
- Application
-
Alternative Names
insE1；Transposase InsE for insertion sequence IS3A
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0CF66
-
Expression Region
1-99aa
-
AA Sequence
MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK
-
Molecular Weight
37.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Insulin-like peptide E1 (insE1) is a significant subject of study due to its role in regulating metabolic processes and its potential implications in treating metabolic disorders, including diabetes and obesity. Recent research indicates that insE1 may have similar functions to insulin, influencing glucose uptake and modulating energy homeostasis. The recombinant expression and purification of insE1 protein have become crucial in understanding its structure-function relationship and biological activity. Advanced techniques such as recombinant DNA technology enable the large-scale production of insE1, providing essential insights into its pharmacokinetics and potential therapeutic applications. Investigating the interactions of insE1 with its receptors and other signaling pathways can reveal novel mechanisms of action, which may lead to the development of innovative therapeutic strategies. Additionally, studying insE1 in various model organisms can help elucidate its physiological significance and therapeutic relevance, making it a focal point within metabolic research. As the prevalence of metabolic diseases continues to rise globally, exploring the characteristics and applications of insE1 offers promising avenues for improving patient outcomes.
