Cat: PA2000-2430

Recombinant E.coli cfaB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    cfaB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    cfaB;BF;BFD;Complement factor B

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0CK93

  • Expression Region

    24-170aa

  • AA Sequence

    VEKNITVTASVDPAIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS

  • Molecular Weight

    31.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CfaB, a key enzyme in the biosynthesis of cyclic fatty acid compounds, has garnered significant attention in the field of biochemical research due to its potential applications in biotechnology and pharmaceuticals. Recent studies have highlighted its role in the modification of lipid metabolism, which can influence various biological processes and disease states, particularly in cancer and metabolic disorders. The recombinant expression of CfaB offers a robust platform for studying its enzymatic mechanisms and substrate specificity, facilitating the production of cyclic fatty acids for therapeutic purposes. Moreover, exploring the structural and functional characteristics of CfaB through techniques such as X-ray crystallography and nuclear magnetic resonance (NMR) can provide insights into enzyme engineering and the design of inhibitors or activators. Understanding the regulatory pathways and interaction networks involving CfaB may also reveal new targets for drug development and metabolic regulation, making it a promising candidate for further investigation in the quest for novel therapeutic strategies. As a result, research focusing on the recombinant protein CfaB is critical for advancing both fundamental science and applied biomedicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US