Analytical Data
-
Gene name
cfaB
- Application
-
Alternative Names
cfaB;BF;BFD;Complement factor B
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0CK93
-
Expression Region
24-170aa
-
AA Sequence
VEKNITVTASVDPAIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS
-
Molecular Weight
31.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CfaB, a key enzyme in the biosynthesis of cyclic fatty acid compounds, has garnered significant attention in the field of biochemical research due to its potential applications in biotechnology and pharmaceuticals. Recent studies have highlighted its role in the modification of lipid metabolism, which can influence various biological processes and disease states, particularly in cancer and metabolic disorders. The recombinant expression of CfaB offers a robust platform for studying its enzymatic mechanisms and substrate specificity, facilitating the production of cyclic fatty acids for therapeutic purposes. Moreover, exploring the structural and functional characteristics of CfaB through techniques such as X-ray crystallography and nuclear magnetic resonance (NMR) can provide insights into enzyme engineering and the design of inhibitors or activators. Understanding the regulatory pathways and interaction networks involving CfaB may also reveal new targets for drug development and metabolic regulation, making it a promising candidate for further investigation in the quest for novel therapeutic strategies. As a result, research focusing on the recombinant protein CfaB is critical for advancing both fundamental science and applied biomedicine.











