Analytical Data
-
Gene name
C21orf127
- Application
-
Alternative Names
N6AMT1; C21orf127; HEMK2; PRED28; Methyltransferase N6AMT1; HemK methyltransferase family member 2; M.HsaHemK2P; Methylarsonite methyltransferase N6AMT1; EC 2.1.1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5N5
-
Expression Region
1-186aa
-
AA Sequence
MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
-
Molecular Weight
46.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C21orf127, also known as chromosome 21 open reading frame 127, is a relatively understudied gene that has gained attention in the context of various cellular processes and potential implications in diseases. Located on chromosome 21, this gene encodes a protein that is believed to have roles in cell proliferation, differentiation, and apoptosis. Recent studies have suggested that C21orf127 may be involved in the pathophysiology of Down syndrome, as it lies within a region of chromosome 21 that is triplicated in individuals with this condition. Its protein product has shown potential interactions with key signaling pathways and may influence neurodevelopmental outcomes. Given its localization and suggested functional roles, the recombinant expression and characterization of C21orf127 protein offer a promising avenue for elucidating its biological functions and exploring its impact in various diseases. Understanding the structure and function of the C21orf127 protein could provide insights into novel therapeutic targets, particularly for conditions associated with chromosome 21 abnormalities. Researchers are now focusing on producing recombinant C21orf127 protein to study its biochemical properties, interactions with other proteins, and functional roles in cellular mechanisms, thereby paving the way for future investigations into the therapeutic potential of modulating its activity in relevant disease contexts.
