Cat: PA2000-6193

Recombinant Human C21orf118 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C21orf118

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96PM8

  • Expression Region

    1-130aa

  • AA Sequence

    MAERGQHRARIVASEGASCKPWQLPCGVEPASAQKSKIGVWEPLPRFQKMYGNAWMPWQK SAVGEGPSWRISARAVQKGNVGSEPQHRIPTGAPPSGAVRRGPPSSRPQNDRSTDSLLHA PGKTADNTSP

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C21orf118, also known as chromosome 21 open reading frame 118, has garnered attention in recent years due to its potential implications in human health and disease. Located on chromosome 21, this gene is of particular interest because of its association with Down syndrome, a condition caused by trisomy of chromosome 21. Research has suggested that C21orf118 may play a role in various cellular processes, including cell proliferation, apoptosis, and response to stress, though its precise functions remain largely undefined. The investigation of recombinant C21orf118 protein is crucial for elucidating its biological role and understanding its contribution to disease mechanisms. Protein expression studies, involving the production of recombinant C21orf118 in various systems, aim to provide insights into its structural and functional characteristics. This research could pave the way for the development of therapeutic strategies targeting C21orf118-related pathways, making it a significant focus within the fields of molecular biology and genetics. The ongoing exploration of C21orf118 not only enhances our understanding of chromosome 21's unique genetic landscape but also has the potential to inform future studies related to developmental disorders and other associated health conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US